Featured

Academy of Sky?

The few stars left below the seaward frown of the vault shine feebly as into the mouth of a black cavern.

Other sizes — Large, Medium, Thumbnail stay inside this column.
Image Courtesy: WordPress.com
02 times? Or 2 times? Manonit or Manoneet?
Morning walks yield beautiful serendipity!

1. This is a brand new weblog.

2. The previous blog had no more space left on it.

3. This weblog has absolutely no followers at present.

4. The thread of discussion is actually something continued from my previous weblog. It’s about language. Hindi and English. Mostly. I can’t promise to stay the course.

5. I remember reading and writing : Maithilisharan Gupt. His verses were in our Hindi syllabus. I was a Hindi medium student.

6. This bust has his name written as Maithleesharan Gupt.

7. Manoneet is written as Manonit.

8. He was a member of legislative assembly twice. That fact is highlighted on this stone bust by using a number : 02 times. Not a grave error. Especially when you are aware of the numbering system used by computers. Importance of zero.

9. The stone was inaugurated by municipal corporation head on 18.01.2016. Time not mentioned.

10. The last image is an image of Sunset. Wanted to keep this first post short and sweet.

11. Another image:

1865-2015

12. The image above was captured two days ago when this coin made its third visit to me within a fortnight or so. It has an image of Lala Lajpat Rai. It was released on his 150th birth anniversary. He was a leader of Garam Dal or Hot Group during the Indian struggle for independence against British colonial rule. The trio of Laal, Baal and Paal was popular.

13. Lalala japatrai is a variation of his name. In the year 2017 I discovered about lalala being a demonic call. Lala is a very common name used for people engaged in business in India.

Timestamp: 07:45 05052022 Pundit Baburam Chaturvedi Stadium Chhatarpur Madhya Pradesh India

Featured

Come Sail Away with Me

Individually, we are one drop. Together, we are an ocean.

On crossing the imaginary line drawn from Punta Mala to Azuera the ships from Europe bound to Sulaco lose at once the strong breezes of the ocean. They become the prey of capricious airs that play with them for thirty hours at a stretch sometimes. Before them the head of the calm gulf is filled on most days of the year by a great body of motionless and opaque clouds. On the rare clear mornings another shadow is cast upon the sweep of the gulf.

post
Full size image larger than or equal to 840px width overflows to the left.

The dawn breaks high behind the towering and serrated wall of the Cordillera, a clear-cut vision of dark peaks rearing their steep slopes on a lofty pedestal of forest rising from the very edge of the shore. Amongst them the white head of Higuerota rises majestically upon the blue. Bare clusters of enormous rocks sprinkle with tiny black dots the smooth dome of snow.

Then, as the midday sun withdraws from the gulf the shadow of the mountains, the clouds begin to roll out of the lower valleys. They swathe in sombre tatters the naked crags of precipices above the wooded slopes, hide the peaks, smoke in stormy trails across the snows of Higuerota. The Cordillera is gone from you as if it had dissolved itself into great piles of grey and black vapours that travel out slowly to seaward and vanish into thin air all along the front before the blazing heat of the day. The wasting edge of the cloud-bank always strives for, but seldom wins, the middle of the gulf. The sun—as the sailors say—is eating it up. Unless perchance a sombre thunder-head breaks away from the main body to career all over the gulf till it escapes into the offing beyond Azuera, where it bursts suddenly into flame and crashes like a sinster pirate-ship of the air, hove-to above the horizon, engaging the sea.

Indeed, these cloudy nights are proverbial with the seamen along the whole west coast of a great continent.

At night the body of clouds advancing higher up the sky smothers the whole quiet gulf below with an impenetrable darkness, in which the sound of the falling showers can be heard beginning and ceasing abruptly—now here, now there. Indeed, these cloudy nights are proverbial with the seamen along the whole west coast of a great continent. Sky, land, and sea disappear together out of the world when the Placido—as the saying is—goes to sleep under its black poncho. The few stars left below the seaward frown of the vault shine feebly as into the mouth of a black cavern. In its vastness your ship floats unseen under your feet, her sails flutter invisible above your head. The eye of God Himself—they add with grim profanity—could not find out what work a man’s hand is doing in there; and you would be free to call the devil to your aid with impunity if even his malice were not defeated by such a blind darkness.

Supercalifragilisticexpialidocious!

Supercalifragilisticexpialidocious!

1. This song was written in 1940s. Its title has a compound word. It’s a funny little Disney song. The song is in AFI’s 100 years 100 songs list.

2. As I said: lyrics is funny: for example:

One night I said it to me girls and now me girls me wife.

Supercalifragilisticexpialidocious

3. I invented the verse form Tohu. I have published many such verses over the years. These verses contain compound words similar to the word in the title song with the exception of being much lengthier compared to them. And meaning? Yes: the meaning is as good as you want it to be. It’s compound of all of the words used and much more since sum is always greater than its parts. Here’s a fresh Tohu. Needless to say: copyright or no copyright it’s one of the longest compound words, similar to other Tohu verses published online in English unrecognised by lexicographers:

Tittermagantennagigglexedrastictactoeuvrevenantuftugulletceteraftermurallohistoryearlyricallymphotonetopealeapunctilliousulcustardentistrystuntsubilkilnoumenonplussedeseutudeuteronomynahamatenetenthomasamiteemuckrakeenichenrezigzagzigguratbaggeryosemittenninedoordonotouthousenesencesernownoosphereticalculustroysomberserkierkeguardentiatrystacknowledgeekedgectomorphilharmonictitateinsofferingulchopinpointedindinabulationoisomeshugasconadebragbromidensemesnescafealtypicalrialtabanidittoiloitermiasmannahannahomilyricsvestibulensecartistellarkspurrupturedragonewithinderfuroruproarteutonickelodianamibianemonebraskalimphoblebengineeredragonefalonedouceurodentroubdourobustubermenschutzpahaphazardiademedicinephilentillisbonehomieidolonosegaymargaywildcatwalkalinoliumpteeneetinyayaverisimilitudeofetudeemfitihasashytonrytonnagemmatrialsomentholonoloanolanmanwanantamarindigenousussurusticicleonasmantidbitubalmobalkylenthrobulbousuburbaneinnuendolittleaniveoysouthernincompooperandampersandarackrucksacknowinsomeinsundarlingtonnespalierratamericanopyratedonutterversevereverseymoreleeryonderodentomologisticsumptuousinequanonethelessonslearntummyinyangulartistenoesisalarmist

Note: If you can recognise the Eiffel tower in the featured image it’s a bonus.

Unsuspecting masses!

Sanchalit or Sanlalit?

1. Big poster. Big cutouts. What for? Education. Distance education. Just below the name: in-your-face SANLALIT course is the Hindi heading for courses offered in distance learning :

There are five categories offered. These courses help you advance your career in education business.

2. Elementary education offered in Hindi is enough to teach the difference between Sanchalit and Sanlalit. It’s a typo. The question arises: an institute offering these courses mounts a poster worth 15000 rupees at many locations: why do they leave such errors?

3. What actually happens in such institutions is not hidden from anyone. Why did the editors team let this poster go out? Is it being careless or smug or following the trend set by today’s Hindi newspapers and political leaders?

4. Below the image of director: Sanchalak which means Conductor or Director. Why not Sanlalak for Sanlalit courses?

5. Here’s a song to celebrate:

6.

Chaska Chai Ka!

Another cafe located nearby. Machine is there but never used. The boy took holiday recently. It’s relatively quiet. Only place where elaichi tea is offered for ten rupees. Coffee is for fifteen rupees per serving. They also hesitate to serve an individual, obviously for time and effort put doesn’t give good returns. Mint tea is there on the menu without actually being given out. Manpower lacking. Machine shut down.

7. I was struggling with machinery for a while recently. Dogs were howling the night before yesterday and someone died recently. Howling of dogs usually is not a good omen. Now candidates for elections for local wards are out from all major political parties. Some of these people are going to become richer by virtue of rich gets richer principle without there really being any change in the shape of events or current state-of-affairs. You should feel fortunate to see their exalted faces in their humblest of days, afterwards they rarely descend down from their utility vehicles.

8. One of my friends: a positive thinker who appreciates the world at large for obvious reasons went as far ahead to say that current DM was letting the wild expansion (hijacking) of his bungalow go back to what it used to be. I thought he might be true because he’s in the circle where people often get to hear ethical discourses from his excellency. The result actually was: broadening of highway on the other side of divider without giving upon the expansion by his excellency. I was dead right in my assumption: as usual my positive thinker friend was using gossip mode in hyperactive imagination. These people, when they’re two or three of them start appreciating eachother with terms like cultural icon, maharaj, dau, this or that: obviously because life is good for nothing and we should continue to add value by being poetic for people around us.

9. If politicians have taught them anything: it’s to never discuss ideas where they had spoken something which was grossly inadequate. Loudly speak on issues where you can and leave the rest to unsuspecting masses.

Jazz!

I think I heard it in Sita Sings Blues couple of years ago.

A Tohu:

Storymyweatheravadapaaventuretinueverettenetcetranschulussulcustardentistrystintegermaneonetamarinderpestuaryosemiteemingdynastylursularinkspurupturedpurrodentomologisticsyllogisticsinequanonethelessonneteereeleeryearlyricallyophilharmonickerchieftaintaintedetonatorporomporousienigmatictactoeuvrentuftingemmatrialsomeshugametenthgatenetcimcummerbunderratamarinderfurorteutonicosmicrophobeliskydaddyaddamsonosegaymargaywildcattaboygirlyricsunstrokententhomsonowhereticalculusundryourstrulyonderenderredandereifyideifyinyangularkspuringulchopinpointedstalksuperbowlowlifelinefelicitylifeelinginsengermanemoneprandialtonesureshotpotioseymorelevancesern

Of Names!

1. This article is inspired by Dainik Bhaskar’s article about village names in Madhya Pradesh state in India. Images are also courtesy of Dainik Bhaskar- Hindi daily. Links are given below:

https://dainik-b.in/EqcIjt2mXqb https://dainik-b.in/download

Bhainsa: Ashok Nagar, Ishagarh.

2. The village above is named Bhainsa. It actually means a buffalo: a male buffalo. It immediately reminded me of Buffalo, New York State, name of which surprised me at first when I heard in a movie.

2443: Saali: Badwaani: Rajpur

3. It’s written as SALI which is pronounced as sully but the Hindi name transcription should be SAALI. Saali is female version of Saala: brother and sister-in-law. Actually these are rarely used in their proper context: most of the times they’re used as swear words. The whole business revolves around this mentality:

Since women are a burden who are grown to be married off to another clan to help them grow and don't really contribute much into the family of birth: the family of marriage of women always has an upper hand on the other family from which they take the loan they owned. Thus Saala and Saali are actually swear curse words often used lightly over hard swear words which have reference to male and female reproductive organs. 
Hastinapur: Gwalior

4. There’s a Hastinapur in Gwalior Madhya Pradesh India. Hastinapur name in itself is a very popular place name since it’s been used as the capital of India in the epic of Mahabharata and usually points to Delhi India.

Hastinapur literally means City of Elephants. Elephants symbolise giants or persons of renown: in the context of epic they’re Kauravas and Pandavas or royal people.

5. The article also details names like Hathnee(female elephant), Galti(Mistake), Maafipura(The place where maafias reside), Udaypur and Gorakhpur(In Chhatarpur district in Madhya Pradesh ( you might already be aware of Chhatarpur in Bihar and Delhi states)), Vrindavan and Hastinapur in Guna district. Nagpur and Agra in Indore district and Ramgarh of Sholay movie fame is in Burhanpur of Madhya Pradesh though actual Ramgarh where shooting for the movie took place is located in Karnataka near Bangalore. The article details many other peculiar names but some of them stand out with: Langoti(loincloth) and Choli(blouse) for example. Haldi(Turmeric), Soda, Chaumau, Azgar(python), Sandal, Charkha, Makdi(spider) and Atoot Bhikhari ( Unbreakable beggar!)

6. Luvkushnagar in the Chhatarpur district was renamed to have names of sons of Rama from epic of Ramayana. Previously it was named: Laundi: it simply means a lady or girl or their reproductive organ. Singular.

7. Chhatarpur Madhya Pradesh India got its name from the root Chhatra which symbolises an umbrella or protective shield wielded by warriors like Chhatrasal the ancient king of this place. It’s similar to the shied of captain America!

8. Bugmau is a village name which can be expanded to mean: bug Mau. Like bugbear.

9. The article in Dainik Bhaskar also states that there are 55000 villages in 52 districts in Madhya Pradesh India.

Narration

Margie’s grandfather once said that when he was a little boy his grandfather told him that there was a time when all stories were printed on paper.

Issac Asimov, The Fun They Had, 1.12.1951

1. As I was narrating this story to my student Sumit- it occurred to me that this sentence, in the very first paragraph, was unusually long for a children’s story.

2. Was it written for children or for adults as a fiction was my first doubt.

3. The quoted sentence is in the reported speech format. I recalled how I used to wonder if narration portion of English grammar which was practiced in the standards eighth and ninth of our school curriculum of English really mattered all that much. After all: you’re supposed to tell your story. What difference does it make if narration uses the first person or third person for the subject?

4. Margie’s father once said “When I was a little boy my grandfather told me that there was a time when all stories were printed on paper.”

The Fun They Had, Issac Asimov.

5. It’s difficult to convey meaning of sentences for students like Sumit who never had good help with English which is a second language for them. Despite being a standard ninth student his reading and writing abilities place him somewhere at standard fourth or fifth of academic achievement. Consider narrating this sentence to such students. They seem inextricably elaborate and complex.

6. For Sumit:

6.1: Margie’s great grandfather told her grandfather about a time when all stories were printed on paper.

6.2: It was in his boyhood.

7. It’s obvious that narration loses all imagination with cut-and-dry approach of explanation used in 6.1 and 6.2.

8. It’s where you need to understand that this story was originally penned to be published in a children’s newspaper in the United States of America.

9. Now look at the layers of narration subjects within this one sentence:

Sumit being the listener of this story hears his teacher. Issac Asimov tells it to his teacher that Margie was listening to her grandfather who was listening to his grandfather.

10. There are seven subjects already involved in the elaborate scheme of things as you read this. Otherwise there are are only two or only one: you!

11. In mythology of Bhagvata Purana there are many such exercises for imagination with multiple layers of narration and storytellers accompanying listeners. I didn’t appreciate it fully until I watched some movies like Rashomon/Inception/Suraj Ka Saatvaan Ghoda etc.

12. Asimov is credited with the invention of robots and compact disc in his stories much before the technology arrived on scene. It so happened that when I first taught this lesson to a CBSE student in 2020 it was during Covid lockdown. She had to attend classes online. It was almost the future author imagined in his fantasy in 2157 AD.

13. I stressed on how 2157 was exactly 300 years after mutiny of 1857 against British empire in Bundelkhand in India. After about a century republic of India was established with constitution elected assembly in operation for making law and executing it. Two centuries after that(actually 200 years after Asimov published this story : he imagined appearance of fully computerized education system.)

14. As with simulation hypothesis arguments related to AI and emerging threat to humanity similar to depicted in the 1990s movie Matrix: it’s true that in many ways the third decade of this century proved that Asimov placed such technological advancements much far ahead in time in his imagination than they actually happened. I think he would have been surprised by it if he was alive.

15. Asimov was founder of MENSA: a non profit organization which promoted education for highly gifted. Asimov himself reportedly had an intelligence quotient in the excess of 200.

Watch “Timeline of Rulers of INDIA (1526-2020)” on YouTube

1. Night before yesterday, in a discussion intended to address the issue of partition in India before its independence, holding Gandhi to be responsible for losses then and now, one of the interlocutors began with this line of reasoning:

“Mughals had already ruled for 800 years.”

2. If this video is based on certain facts: 1526 AD to 1674 AD is only 148 years. It actually took me a while to bring him to a reasonable ground where he was willing to agree on a figure of 300 years. Why does our imagination exaggerate things especially in case of religion? It’s upto you to think at present. I intend to keep this article based on data available online, verifiable by anyone with an internet connection and a smartphone.

3. As one of the comments observed: son of Indira Gandhi is named Indira Gandhi in this video. Might be poignant but would be registered only as a technical error.

4. It must be noted: using umbrella term ‘rulers of India’ is actually invalid for people represented to be working on behalf of East India Company or Republic of India post independence. It’s what creates an image of Modi or Chouhan being sovereign rulers of state in the mind of youth and it’s grossly mistaken notion.

Eh?

Pundit Baburam Chaturvedi Stadium Chhatarpur Madhya Pradesh India

1. As I was reading an article on beach it occurred to me that the way it’s pronounced in Hindi is beech which means middle. The Sanskrit word contributing to pure Hindi would be Madhya. Madhya contributes to madhyam, maddham(mild) etc. In a way it’s true that it defines ‘the wet sand between water and land.’ The word might have been brought by ships which came exploring India for I am unsure about its origins. Middle part between vast waters of ocean and land is illusory for you don’t know where one ends and the other begins.

2. Tsunami and deluge. Tsunami sounds like it’s a word with ‘su’ prefix to nami which means name. Thus tsunami would translate to Hindi as ‘something which has a good name.’ Noah’s arc.

3. Noah is the name of a neighborhood dog barking from rooftop. I was reading about Noah Webster’s groundbreaking work for American English language. Benjamin Franklin and Thomas Jefferson were inventors and statesmen who had to master almost every department of living in their days to make it worth their while and a few centuries later people thought they were universal geniuses, polymaths and so on. Some people were at some places at some times and they were recorded as significant causes for certain changes which were taking place. This made them heroes or villains of their times.

4. Eh? In the same book, in the same chapter I read a bit about how distinct Canadian English language is. So far I was under the impression that ‘eh?’ was originally a British usage.

Mug!

5. Tea in red earthenware tastes different from the tea in led glasses and it tastes different in chinaware.

Forehead forrid got rid of lot of ids.

For head heads along shores of reason!

Resplendent chores resonate.

Ate very late ait it ain’t tainted candidates.

Dates gone through rough terrain rain.

Sedate see date sea seed deed mead enneadeaneedeinnuendoubtincturemnantennamesakeratosisisiestabaniditestamentationoumenoesisomercuriallohistoricitylightsimsummummerbonermuremburgermanemoneonoununthelessonoonomatopoeiaitingentryennobitamarinderfurorteutonicussuctionorwaygianniversaryoursuresowonincompoopooperandindinabulationowheretowithalamustardentistrystitmeanswhatitmeanswerinematodensemesnescafelinefelicitylightswiftightwaddlepatenetsukeynoteemingdynastylustrousudorifictionoisenamibiamberserkierkeguardenmarksmanshipwreckedeckierkegaardurockrasterlingastronomicalculusumplumugwumpunterrafirmamenthollonovembermudaldantianictitatemesisonatammyosemiteparkouroustaboutoutiffinnishinbonetzahummingbirdswordswardebturfulcrumuttermitenthgatengentryonderratapatanamnameowlowlifencesernebraskamikazephyrodentistrystutahattahamburgermannahannahunchopinchinchinatihullabalustradeleteriousufructsimcardoorwaywardennearmarkedofficecoolooccludenowinsomentholoninzaturtlensecarticleonasmeraldaldampsonoshoguntiedinteger

Bonus track:

Thanks for the memory,
Of sentimental verse,
Nothing in my purse,
And chuckles,
When the preacher said
For better or for worse,
How lovely it was!

6. Attention span of goldfish is greater than human attention span.

Psychology section: UNWFP Free Rice game.

Like dreams that which has no beginning or end has no middle either!

Unknown

Would you like to swing on a star, carry moonbeams home in a jar?

Wikipedia: Educational courtesy!
Google search
UNWFP: Free Rice: Psychology section!
Milestone blue LEGAND!
Moonbeams home in a jar!

1. I was listening to AFI’s 100 years 100 songs playlist on Google Spotify when I came across this track. Music composed by Jimmy Van Heusen and lyrics by Johnny Burke. I might have come across this one last year when I was watching classic movies from Hollywood.

2. However what I didn’t appreciate last year was lyrics. These used to be tagline of Willem from Belgium. I asked him what his forum name meant: William as in Williamthe protector he told. I never forgot it afterwards but his tagline seemed like it was picked off from some nursery rhymes book. His avatar actually reflected it as a boy hanging on a Moonbeam.

3. Willem was one of the moderators on forum. Susan who had her birthday recently was the admin of this small forum known as The Couch. Paul used to do technical support time-to-time and Brian aka Monk2400 aka Midnight monk was Philosophy major. Henry Quirk from Voice of Lafayette, Louisiana was there for a while. He was also on Mad Philosophers where I first interacted with Chinese philosopher Xanthos who after a heated debate on The Couch moved onto a Science discussion forum.

4. Incidentally, United Nations World Food Programme website Free Rice introduced two new categories in their free gaming section which educates and helps you help alleviate the hunger in the world: Psychology and Economics.

Thus they now have 54 categories instead of 52. Psychology section had a question with a grammatical mistake in the last option. I tried to notify them of it on Facebook where I had previously interacted with one of their technical supports. (The Couch and Psychology section)

5. Needless to say that the correct answer in the question shown associates watching more television with unhappiness. Couch potato is another term associated with this pattern.

6. The second last image in this sequence of images has a menu of liquor items I saw this evening as we went to buy a drink for my friend who drinks regularly and needs company. Legend is spelt as LEGAND. You need to click onto the picture of menu and amplify the resolution to be able to spot it. It shall be a test for your seriousness. Else: never mind fir else fur Elise Elijah ah!

7. Full moon for this month of Jyeshtha constellation is celebrated as birthday of Kabir. After my research I noticed that full moon days were assumed to be birthdays of saints and mystics no matter what their exact birthdays were. In case of Kabir birth month might be accurate. Since Jyeshtha Sun is hottest in this part of globe: Moon merely reflects that lustre. Hence Kabir( al-kabir a name of God in Quran which means ‘the great one’ ) as the name suggests has most illustrious moon for his birthday.

Twelfth of June!

1. Yesterday, I left in time to capture some images to be used to compose this article.

2. I got a call from a friend before I left. He wanted to meet casually but then took me to a barber’s saloon where he got shaved while I insisted to walk in stadium. Thus my twilight was spent on a bench watching traffic police giving challan receipts to violators near Ambedkar statue.

3. The stone outside the badminton hall of Pundit Baburam Chaturvedi Stadium Chhatarpur Madhya Pradesh India is worn out because of passage of time since its inception. It was inaugurated on Twelfth of June in the year nineteen ninety four by chief minister of Madhya Pradesh state Digvijaya Singh. Now it’s difficult to identify if it was on second of June or twelfth of June as the number one is illegible. Synchronicity: it was a Sunday on the day of inauguration of the hall. It was a Sunday yesterday as well.

4. My inclination to often write about this hall stems from my early boyhood memory of visiting stadium and this hall with Lallu aka Aditya Dwivedi. He was elder to me and introduced me to terms like Stadium/Pavilion. It took me some time to clearly comprehend the difference. Recently I read a tweet from Tendulkar where he used term pillion. This word is similar to the word pavilion in structure but means a rider accompanying another. I used to be a pillion on bicycle driven by Lallu bhaiyaa. He used to eat only a bit between two rounds to stadium and mimicked Kishore Kumar very well.

5. The last image is GI iron alloyed poles to be installed in place of old ones which used to act as goal posts for football game so far. In a ceremony held to inaugurate some scheme by chief minister of Madhya Pradesh India a heavy tent was pitched and poles were uprooted. Two pairs now rest before Gymnashium Hall and East Side pavilion stairs. The installation has been pending with the risk of any animal or youngsters falling in those four ditches.

6. Tenders have been invited for renovation of floor plan and other activities inside the badminton hall. There have been many discussions, petitions and publications for the same before an official visit from a UGC committee.

7. If I failed to find out what RFS stood out for it’s clearly futile to try to find out the meaning of acronym AKV on one of the poles.

8. I am listening to music. Unchained melody was discovered when I watched 1990 movie Ghost and then I found that it has many versions.

Unchained melody: https://open.spotify.com/track/2qhASBzpbFhPRtrnZ5lLnz?si=qceJXE6ZQjemmSL1Ar4MWQ&utm_source=copy-link

“…And time goes by so slowly…and time can do so much…” Alex North and co. Righteous brothers.

Alex North and Hy Zaret

9. Here’s a Tohu to celebrate twenty eight years of badminton hall stone:

Battledore Dumbledore,

Adore adore!

POonA Pune Juna June!

Jejune junebug bugsbunny hunny!
Jejunemesisaltarrastasisisamayamamotorollambastellarkspurupturedragonfalonolanameinsofferinglenookierkeguardentistrystigmatamarinderpestoonsimulacrassashytonotorietycoonoonomadmonishingoonameinkamfowlomonsooninzapplentilousyllogismiasmantidbitihasanguineptitudeuteronomyantrashindigoannamannahamatenthomasedonaitickinsiesmicosineffectincturestivectorsororityinnuendolittlenneagrammatonnagemmatrialsomeshugasconadefinitionomatopoeiambicicinoutoutheloutshoutaboutsproutsnouthousenescencementationaganamanamericanopyratestestanentingentrystintelligentomologisticsv

The Story of English!

The Story of English
Background

1. I am reading this book by Robert McCrum, William Cran and Robert MacNeil. Just completed reading preface today.

2. It was in my cellar with couple of old journals. On August 20th, 2009 I entrusted fifty books to my sibling along with many journals in Bhopal as I was planning to move to Pune for a job in an IT firm.

3. Later, I burnt away all the journals except some which were eaten away by termite. Collection of the books was meagre. It was not reflective of what I actually read during four years of college as I was a member of British Library in Bhopal. I was lazy to visit library regularly. I preferred reading articles on websites in a nearby internet cafe. It was inception for Jimmy Wales’ Wikipedia: always in dire need for funds these days. I found it to be a wonderful source of information. I kept reading criticism which refused to regard it as an authentic source of information in debates. I began frequenting discussion forums like The Couch and Mad Philosophers on internet. They were a help in those days.

4. I don’t remember where I found this book. I either bought it second-hand or from a book fair as I used to visit them sometimes. Now as I rarely read any books I think it would be a good idea to read it. There’s a Whatsapp group which was created with an intention to discuss some ideas and new books but all we do over there is to share some jokes and news.

5. The rate at which this language evolved and grew in vocabulary is in itself a miracle. We engineering students; well most of us, had no idea that this language which created nightmares for us had a very humble database at the times of Shakespeare. Preface emphasizes this fact.

6. If you need any first-hand observations which compare it with any other languages of national importance: take Hindi. Constant abuse and misuse of language is one of the facts highlighted in day-to-day life. Hindi dictionaries were rarely bought and sold in the decades I grew up in this country. There’s almost no effort to preserve the language and improve it as literati did it especially during Indian struggle for independence against British. You find misspellings and inaccurate grammar in Hindi newspapers with most powerful circulation. You find the same in campaign slogans for religious, political and educational movements. No wonder this lack of discipline is merely a reflection of attitude of Hindi belt. Bengali and Tamil speaking regions have treated their language with much greater discipline and care.

Create your website with WordPress.com
Get started